AlphaFold3

This section covers AlphaFold3 macromolecular structure prediction on HPC clusters. It describes what HPC admins need to be aware of from the official AlphaFold3 installation and runtime requirements, and how TACC provides AlphaFold3 via a container and module file (e.g. on Lonestar6).

What is AlphaFold3?

AlphaFold3 is Google DeepMind’s deep learning system for predicting the three-dimensional structure of proteins and other biological macromoleculesfrom their amino acid (or nucleotide) sequences. AlphaFold3 (2024) extends the approach of AlphaFold2 (2021) to predict the structure and interactions of proteins, nucleic acids, small molecules, ions, and post-translational modifications in complexes. It also represents a significant improvement in protein structure prediction over AlphaFold2.

The source code is available on GitHub, and AlphaFold3 depends on roughly 630 GB of disk space to keep genetic databases for querying (SSD storage is recommended).

In addition, AlphaFold3 requires an NVIDIA GPU with Compute Capability 8.0 or greater. GPUs with more memory can predict larger protein structures. It is recommended to have at least 64 GB of RAM.

  • The code is licensed under CC-BY-NC-SA 4.0; the AlphaFold3 model parameters and output are only available for non-commercial use only. You must not use nor allow others to use:

    • AlphaFold3 model parameters or output for any commercial activities

    • AlphaFold3 output to train machine learning models or releated technology

  • Do not publish or share AlphaFold3 model parameters – have your users fill out this form to obtain the model parameters

  • Installation instructions are here

  • Input is one or more JSON files

  • The pipeline runs MSA (multiple sequence alignment) and template search (data pipeline, can run on CPU), then neural-network inference (requires GPU) to produce predicted structures (e.g. PDB, CIF, confidence scores). The data pipeline and inference steps can be run separately using --norun_inference and --norun_data_pipeline flags.

Why it’s relevant

For HPC clusters that serve structural biology or biochemistry users, AlphaFold3 is often requested for:

  • Multi-molecule structure prediction — Unlike AlphaFold2 (proteins only), AlphaFold3 predicts structures of proteins, nucleic acids (DNA/RNA), small molecules, ions, and post-translational modifications in complexes. This enables modeling of protein–DNA, protein–RNA, protein–ligand, and other multi-component systems.

  • Improved protein structure accuracy — AlphaFold3 represents a significant improvement over AlphaFold2 for protein structure prediction, making it preferred for new projects when available.

  • Complex interaction modeling — Predicts how different molecule types interact (e.g. transcription factors with DNA, enzymes with cofactors or substrates, ribonucleoprotein complexes).

  • Hypothesis generation — Before wet-lab experiments or as part of integrative modeling pipelines, particularly for systems involving multiple molecule types.

Key differences from AlphaFold2:

  • Input format: JSON files (not FASTA) that can specify multiple molecule types and their relationships.

  • Scope: Handles nucleic acids, small molecules, ions, and PTMs in addition to proteins.

  • Accuracy: Improved protein structure prediction compared to AlphaFold2.

  • Licensing: Non-commercial use only (CC-BY-NC-SA 4.0); model parameters must be requested separately and cannot be redistributed.

Supporting AlphaFold3 means providing a container or module environment, access to reference databases, clear guidance on GPU partitions and walltime, and clear guidelines regarding licensing restrictions and the model-parameter request process (users must obtain parameters from Google).

Why this matters for HPC admins

The following points are drawn from the official AlphaFold3 installation section and related documentation.

  1. Operating system:

    AlphaFold3 runs on Linux only; other operating systems are not supported.

  2. Disk space:

    Full installation requires up to 1 TB of disk space to hold genetic databases.

    • Download size: Approximately 252 GB for the full databases.

    • Unzipped size: Approximately 630 GB when decompressed.

    • SSD storage is recommended for better genetic search performance.

    • The download directory should not be a subdirectory of the AlphaFold3 repository directory (to avoid slow Docker builds).

  3. GPU:

    • An NVIDIA GPU with Compute Capability 8.0 or greater is required (e.g. A100, H100). GPUs with more memory can predict larger structures.

    • Verified: Inputs with up to 5,120 tokens can fit on a single NVIDIA A100 80 GB or a single NVIDIA H100 80 GB.

    • AlphaFold3 inference requires GPUs; the data pipeline (MSA and template search) can run on CPU.

  4. Memory (RAM):

    At least 64 GB RAM recommended, especially for long targets where the genetic search stage can consume significant memory.

  5. CUDA:

    The Docker container requires that the host machine has CUDA 12.6 installed. For local installations outside Docker, ensure CUDA, cuDNN, and JAX are correctly installed.

  6. Containers:

    AlphaFold3 is typically run via Docker with the NVIDIA Container Toolkit for GPU support, or Singularity/Apptainer on HPC systems. Database paths and bind mounts (input, output, model parameters, public databases) must be configured correctly; the TACC module and alphafold3-config repo define these for TACC systems.

  7. Genetic databases:

    AlphaFold3 needs multiple genetic (sequence) databases: BFD small, MGnify, PDB (mmCIF), PDB seqres, UniProt, UniRef90, NT (nucleotide), RFam, and RNACentral. The fetch_databases.sh script downloads and sets up all databases. Permissions: If the download directory does not have full read/write permissions, MSA tools can fail with opaque errors; the docs suggest chmod 755 --recursive "$DOWNLOAD_DIR" if needed.

  8. Model parameters:

    Model parameters are not redistributable by HPC sites. Users must request access via the AlphaFold3 Model Request Form and download them directly from Google. Document this clearly and point users to the request process. Parameters should be placed in a directory outside the AlphaFold3 repository directory (we recommend users put model parameters in their $HOME or $WORK directories).

  9. Storage and I/O:

    Running from a fast filesystem (e.g. scratch) is recommended.

Installations and access at TACC

TACC provides AlphaFold3 as a container image plus a Lua module file that exposes a single entry point so users do not need to invoke Apptainer directly. Data (databases) and examples live on shared paths; model parameters are not included—users must obtain them from Google and set AF3_MODEL_PARAMETERS_DIR to their own copy.

Container

  • Container Image: tacc/alphafold3:3.0.1

  • On the cluster, the image is built as an Apptainer SIF, e.g., /scratch/tacc/apps/bio/alphafold3/3.0.1/images/alphafold3_3.0.1.sif

  • The container is invoked via a wrapper that runs AlphaFold3 with the correct bind mounts for input, output, model parameters, and public databases (e.g. run_alphafold.py with --json_path, --model_dir, --db_dir, --output_dir as documented by TACC and the AlphaFold3 repo).

Module file

The module file sets the environment and defines a shell function run_alphafold3 that runs the container with GPU support (--nv) and passes through any user arguments. Example Lua content (as used at TACC):

local help_message = [[
This is a module file for the container tacc/alphafold:3.0.1, which exposes the
following program:

- run_alphafold3

This command launches AlphaFold3 inside an Apptainer container using GPU support.
You must define the following variables before running:

  export AF3_INPUT_DIR=/your/json/dir
  export AF3_OUTPUT_DIR=/your/output/dir
  export AF3_MODEL_PARAMETERS_DIR=/your/model/parameters/dir

This container was pulled from:

  https://hub.docker.com/r/tacc/alphafold3

If you encounter errors in alphafold or need help running the
tools it contains, please find supporting documentation at:

  https://portal.tacc.utexas.edu/software/alphafold3

]]

help(help_message, "\n")

whatis("Name: alphafold3")
whatis("Version: 3.0.1-f3e86f2")
whatis("Category: Bioinformatics")
whatis("Keywords: Container, AlphaFold3")
whatis("Description: AlphaFold3 run environment using TACC container image.")
whatis("URL: https://github.com/google-deepmind/alphafold3")

-- Environment vars
setenv("AF3_HOME", "/scratch/tacc/apps/bio/alphafold3/3.0.1")
setenv("AF3_IMAGE", "/scratch/tacc/apps/bio/alphafold3/3.0.1/image/alphafold3_3.0.1-f3e86f2.sif")
setenv("AF3_CODE_DIR", "/scratch/tacc/apps/bio/alphafold3/3.0.1/code_TEST")
setenv("AF3_DATABASES_DIR", "/scratch/tacc/apps/bio/alphafold3/3.0.1/data")

-- Load dependencies
always_load("tacc-apptainer")
try_load("cuda/12.2")

-- Shell function
set_shell_function("run_alphafold3",
"apptainer exec --nv " ..
"  ${XLA_PYTHON_CLIENT_PREALLOCATE:+--env XLA_PYTHON_CLIENT_PREALLOCATE=$XLA_PYTHON_CLIENT_PREALLOCATE } " ..
"  ${TF_FORCE_UNIFIED_MEMORY:+--env TF_FORCE_UNIFIED_MEMORY=$TF_FORCE_UNIFIED_MEMORY } " ..
"  ${XLA_CLIENT_MEM_FRACTION:+--env XLA_CLIENT_MEM_FRACTION=$XLA_CLIENT_MEM_FRACTION } " ..
"  --bind $AF3_INPUT_DIR:/root/af_input " ..
"  --bind $AF3_OUTPUT_DIR:/root/af_output " ..
"  --bind $AF3_MODEL_PARAMETERS_DIR:/root/models " ..
"  --bind $AF3_DATABASES_DIR:/root/public_databases " ..
"  $AF3_IMAGE " ..
"  bash -c ' " ..
"    args=(\"$@\"); " ..
"    for i in \"${!args[@]}\"; do " ..
"      if [[ ${args[$i]} == --json_path=* ]]; then " ..
"        val=${args[$i]#--json_path=}; " ..
"        args[$i]=--json_path=/root/af_input/$(basename \"$val\"); " ..
"      fi; " ..
"    done; " ..
"    python $AF3_CODE_DIR/run_alphafold.py " ..
"      --output_dir=/root/af_output " ..
"      --model_dir=/root/models " ..
"      --db_dir=/root/public_databases " ..
"      \"${args[@]}\"; " ..
"  ' -- \"$@\"",
-- C-shell version
"apptainer exec --nv " ..
"  ${XLA_PYTHON_CLIENT_PREALLOCATE:+--env XLA_PYTHON_CLIENT_PREALLOCATE=$XLA_PYTHON_CLIENT_PREALLOCATE } " ..
"  ${TF_FORCE_UNIFIED_MEMORY:+--env TF_FORCE_UNIFIED_MEMORY=$TF_FORCE_UNIFIED_MEMORY } " ..
"  ${XLA_CLIENT_MEM_FRACTION:+--env XLA_CLIENT_MEM_FRACTION=$XLA_CLIENT_MEM_FRACTION } " ..
"  --bind $AF3_INPUT_DIR:/root/af_input " ..
"  --bind $AF3_OUTPUT_DIR:/root/af_output " ..
"  --bind $AF3_MODEL_PARAMETERS_DIR:/root/models " ..
"  --bind $AF3_DATABASES_DIR:/root/public_databases " ..
"  $AF3_IMAGE " ..
"  python $AF3_CODE_DIR/run_alphafold.py " ..
"    --output_dir=/root/af_output " ..
"    --model_dir=/root/models " ..
"    --db_dir=/root/public_databases " ..
"    $*")

What this does

  • set_shell_function("run_alphafold3", ...): Defines the command run_alphafold3 so that when users run it (with --json_path, environment variables for input/output/model dirs, etc.), the module invokes apptainer exec --nv with the correct SIF path and bind mounts, passing $@ (Bash) or $* (C-shell).

  • setenv("AF3_HOME", ...) and AF3_DATABASES_DIR: Set the AlphaFold3 install root and shared database path; scripts or docs can reference these for the image path and data location.

  • always_load("tacc-apptainer"): Ensures the Apptainer environment is loaded.

  • try_load("cuda/12.8"): Loads a CUDA version compatible with the container’s GPU stack (AlphaFold3 requires CUDA 12.6 for the Docker container); --nv then exposes the GPU.

Users load the module (e.g. module load alphafold3/3.0.1-ctr), set AF3_INPUT_DIR, AF3_OUTPUT_DIR, and AF3_MODEL_PARAMETERS_DIR, then run run_alphafold3 with --json_path pointing to their input JSON file.

Running AlphaFold3 on TACC systems

Directory structure

Run from $SCRATCH (recommended). A typical project layout:

alphafold3_project/
├── input/
│   └── example_input.json
├── output/
└── slurm_jobs/

Input preparation

You can provide inputs to AlphaFold3 in one of two ways:

  • Single input file: Use the --json_path flag followed by the path to a single JSON file.

  • Multiple input files: Use the --input_dir flag followed by the path to a directory of JSON files.

An example JSON input file is provided below:

{
  "name": "UQCR11_Hsapiens",
  "sequences": [
    {
      "protein": {
        "id": "A",
        "sequence": "MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN"
      }
    }
  ],
  "modelSeeds": [1],
  "dialect": "alphafold3",
  "version": 1
}

Required environment variables in job scripts:

  • AF3_INPUT_DIR — Directory containing the input .json (e.g. $SCRATCH/input).

  • AF3_OUTPUT_DIR — Where output will be written (e.g. $SCRATCH/output).

  • AF3_MODEL_PARAMETERS_DIR — Directory where you placed the downloaded AlphaFold3 model parameters (e.g. $WORK/af3_parameters).

Example 1: Single protein prediction (full run on GPU)

This job runs the full AlphaFold3 pipeline (MSA + inference) on a GPU node.

AF3_protein.slurm (Lonestar6)
#!/bin/bash
#----------------------------------------------------------------------
#SBATCH -J AF3_protein             # Job name
#SBATCH -o AF3_protein.o%j         # Name of stdout output file
#SBATCH -e AF3_protein.e%j         # Name of stderr error file
#SBATCH -p gpu-a100-small          # Queue (partition) name
#SBATCH -N 1                       # Total # of nodes
#SBATCH -t 01:00:00                # Run time (hh:mm:ss)
#SBATCH -A <your-allocation>       # Allocation name
#----------------------------------------------------------------------

# Load required modules
module use /scratch/tacc/apps/bio/alphafold3/modulefiles
module load alphafold3/3.0.1-ctr

# Set paths
export AF3_INPUT_DIR=$SCRATCH/alphafold3_project/input/
export AF3_OUTPUT_DIR=$SCRATCH/alphafold3_project/output/
export AF3_MODEL_PARAMETERS_DIR=$WORK/af3_parameters

run_alphafold3 --json_path=$AF3_INPUT_DIR/input.json

Submit with: sbatch AF3_protein.slurm.

Example 2: MSA and inference separately (CPU then GPU)

Splitting the run into two stages saves GPU time: run the data pipeline (MSA and template search) on a CPU node, then run only inference on a GPU node. See AlphaFold3 performance documentation.

Step 1 — MSA only (CPU queue):

protein_MSA.slurm
#!/bin/bash
#SBATCH -J protein_MSA
#SBATCH -o protein_MSA.o%j
#SBATCH -e protein_MSA.e%j
#SBATCH -p normal                  # Normal (CPU) queue
#SBATCH -N 1
#SBATCH -t 01:00:00
#SBATCH -A <your-allocation>

module use /scratch/tacc/apps/bio/alphafold3/modulefiles
module load alphafold3/3.0.1-ctr

export AF3_INPUT_DIR=$SCRATCH/input/
export AF3_OUTPUT_DIR=$SCRATCH/output/
export AF3_MODEL_PARAMETERS_DIR=$WORK/af3_parameters

run_alphafold3 --json_path=$AF3_INPUT_DIR/input.json --norun_inference

The output directory will contain a subdirectory named from the name field in your input.json (e.g. uqcr11_hsapiens) with a *_data.json file for the inference step.

Step 2 — Inference only (GPU queue):

protein_inference.slurm
#!/bin/bash
#SBATCH -J protein_inf
#SBATCH -o protein_inf.o%j
#SBATCH -e protein_inf.e%j
#SBATCH -p gpu-a100-small
#SBATCH -N 1
#SBATCH -t 01:00:00
#SBATCH -A <your-allocation>

module use /scratch/tacc/apps/bio/alphafold3/modulefiles
module load alphafold3/3.0.1-ctr

export AF3_INPUT_DIR=$SCRATCH/output/uqcr11_hsapiens
export AF3_OUTPUT_DIR=$SCRATCH/output/uqcr11_hsapiens
export AF3_MODEL_PARAMETERS_DIR=$WORK/af3_parameters

run_alphafold3 --json_path=$AF3_INPUT_DIR/uqcr11_hsapiens_data.json --norun_data_pipeline

Important: AF3_INPUT_DIR and --json_path must point to the directory and *_data.json file produced in Step 1.

Using multiple GPUs on a node

AlphaFold3 uses only one GPU per run; it does not split a single prediction across GPUs. To use three (or more) GPUs on the same node, run three independent run_alphafold3 jobs in parallel, each with its own --json_path and output directory, and pin each run to a different GPU with CUDA_VISIBLE_DEVICES.

Example: run 3 folds at once on a node with 3 GPUs. Use different input JSON files and set AF3_INPUT_DIR and AF3_OUTPUT_DIR per run so outputs do not overwrite each other.

protein_3gpu.slurm — 3 predictions in parallel
#!/bin/bash
#SBATCH -J af3_3gpu
#SBATCH -o af3_3gpu.o%j
#SBATCH -e af3_3gpu.e%j
#SBATCH -p gpu-a100
#SBATCH -N 1
#SBATCH -t 02:00:00
#SBATCH -A <your-allocation>

module use /scratch/tacc/apps/bio/alphafold3/modulefiles
module load alphafold3/3.0.1-ctr

export AF3_INPUT_DIR=$SCRATCH/input/
export AF3_OUTPUT_DIR=$SCRATCH/output/
export AF3_MODEL_PARAMETERS_DIR=$WORK/af3_parameters

# Run three predictions in parallel, one per GPU
CUDA_VISIBLE_DEVICES=0 --json_path=$AF3_INPUT_DIR/input_1.json &
CUDA_VISIBLE_DEVICES=1 --json_path=$AF3_INPUT_DIR/input_2.json &
CUDA_VISIBLE_DEVICES=2 --json_path=$AF3_INPUT_DIR/input_3.json &


wait

Notes for admins

  • CPU and RAM: Running three predictions on one node roughly triples CPU and memory use during MSA and inference. Ensure the partition’s per-node resources (e.g. 64 GB RAM or more for three runs) are sufficient.

  • GPU binding: Without CUDA_VISIBLE_DEVICES, all processes may use GPU 0. Pin each run to a specific GPU (e.g. 0, 1, 2) so the three runs use different devices.

Output

AlphaFold3 generates multiple output files for each prediction. Here is what the output directory for one JSON input file looks like:

$ ls -lh
total 459K
drwx------ 2 kbeavers G-827556    3 Feb 19 13:53 seed-1_sample-0/
drwx------ 2 kbeavers G-827556    3 Feb 19 13:53 seed-1_sample-1/
drwx------ 2 kbeavers G-827556    3 Feb 19 13:53 seed-1_sample-2/
drwx------ 2 kbeavers G-827556    3 Feb 19 13:53 seed-1_sample-3/
drwx------ 2 kbeavers G-827556    3 Feb 19 13:53 seed-1_sample-4/
-rw------- 1 kbeavers G-827556  13K Feb 19 13:53 TERMS_OF_USE.md
-rw------- 1 kbeavers G-827556  31K Feb 19 13:53 UQCR11_Hsapiens_confidences.json
-rw------- 1 kbeavers G-827556 367K Feb 19 13:52 UQCR11_Hsapiens_data.json
-rw------- 1 kbeavers G-827556  44K Feb 19 13:53 UQCR11_Hsapiens_model.cif
-rw------- 1 kbeavers G-827556  146 Feb 19 13:53 UQCR11_Hsapiens_ranking_scores.csv
-rw------- 1 kbeavers G-827556  246 Feb 19 13:53 UQCR11_Hsapiens_summary_confidences.json

Output file descriptions

File and directory names are prefixed by the name field from your input JSON (e.g. UQCR11_Hsapiens). The most important outputs are:

  • <name>_model.cif: The best-ranked predicted structure in mmCIF format. This is the primary output for visualization and analysis (e.g. in PyMOL, ChimeraX, or for deposition).

  • <name>_confidences.json: Per-residue (and per-pair) confidence scores for the prediction. Use this to assess reliability; low-confidence regions may be disordered or uncertain.

  • <name>_summary_confidences.json: Summary confidence metrics (e.g. overall or chain-level scores) in JSON form.

  • <name>_ranking_scores.csv: Ranking of the different model samples (e.g. seed-1_sample-0 through seed-1_sample-4). The model with the best score corresponds to the structure in <name>_model.cif.

  • seed-1_sample-0/seed-1_sample-4/: Directories containing outputs for each of the five model samples (seeds). AlphaFold3 runs multiple samples and ranks them; the top-ranked structure is also written as <name>_model.cif. These directories hold per-sample structures and metadata if you need them.

  • <name>_data.json: Intermediate data produced by the pipeline (e.g. MSA and feature data). Large file (~367K in the example); used when splitting data-pipeline and inference steps or for debugging.

  • TERMS_OF_USE.md: AlphaFold3 terms of use.

For most users: Start with <name>_model.cif for the best predicted structure, and use <name>_confidences.json or <name>_summary_confidences.json to check confidence. Low confidence values indicate regions to interpret with caution.

Common problems and performance

  • Model parameters not found: Ensure users have requested and downloaded AlphaFold3 parameters from Google and set AF3_MODEL_PARAMETERS_DIR to the directory where they were extracted. The module does not provide parameters.

  • GPU memory (OOM): AlphaFold3 is tuned for 1× A100 (80 GB) or 1× H100 (80 GB). For larger systems or smaller GPUs (e.g. A100 40 GB), unified memory and/or sharding may be needed; see the AlphaFold3 performance documentation (e.g. XLA_PYTHON_CLIENT_PREALLOCATE=false, TF_FORCE_UNIFIED_MEMORY=true, XLA_CLIENT_MEM_FRACTION=3.2). The TACC module can pass these through if set in the job environment.

  • Data pipeline slow or I/O bound: MSA and template search are CPU- and disk-intensive. Running on a RAM-backed filesystem or fast SSD and increasing CPU cores can help. For very large-scale runs, the performance doc describes sharded genetic databases and parallelisation (e.g. Jackhmmer with multiple shards).

Additional resources